Pay in 4 interest-free payments of $6.47 Learn more
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
For part 1 (short-term capital gains and losses), fill out either line 1a, 1b, 2, or 3
Immune and inflammatory mechanisms in neuropathic pain
Description Chemical Information of Cagrilintide 5mg Molecular Formula: CHNO CAS Number: 1415456-99-3 Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information
It received FDA approval as Mounjaro for type 2 diabetes and subsequently as Zepbound for weight management
US$ 28.52
US$ 27.68
US$ 23.45
US$ 23.78
